Lineage for d1thfd_ (1thf D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566370Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1566371Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 1566384Species Thermotoga maritima [TaxId:2336] [51371] (4 PDB entries)
  8. 1566385Domain d1thfd_: 1thf D: [28535]
    complexed with po4

Details for d1thfd_

PDB Entry: 1thf (more details), 1.45 Å

PDB Description: cyclase subunit of imidazoleglycerolphosphate synthase from thermotoga maritima
PDB Compounds: (D:) hisf protein

SCOPe Domain Sequences for d1thfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgsnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

SCOPe Domain Coordinates for d1thfd_:

Click to download the PDB-style file with coordinates for d1thfd_.
(The format of our PDB-style files is described here.)

Timeline for d1thfd_: