Lineage for d1treb_ (1tre B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1565957Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1565958Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1565959Protein Triosephosphate isomerase [51353] (20 species)
  7. 1566019Species Escherichia coli [TaxId:562] [51361] (1 PDB entry)
  8. 1566021Domain d1treb_: 1tre B: [28506]

Details for d1treb_

PDB Entry: 1tre (more details), 2.6 Å

PDB Description: the structure of triosephosphate isomerase from escherichia coli determined at 2.6 angstrom resolution
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d1treb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1treb_ c.1.1.1 (B:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]}
mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim
lgaqnvnlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg
ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp
aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad
afavivkaaeaak

SCOPe Domain Coordinates for d1treb_:

Click to download the PDB-style file with coordinates for d1treb_.
(The format of our PDB-style files is described here.)

Timeline for d1treb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1trea_