SCOPe 2.01: Domain d3tima_: 3tim A:

Lineage for d3tima_ (3tim A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)

8. Domain d3tima_: 3tim A: [28483]

Details for d3tima_

PDB Entry: 3tim, 2.8 Å

PDB Description: the crystal structure of the "open" and the "closed" conformation of the flexible loop of trypanosomal triosephosphate isomerase

PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3tima_:

Sequence; same for both SEQRES and ATOM records:

>d3tima_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq
qaqeahalirswvsskigadvrgelrilyggsvngknartlyqqrdvngflvggaslkpe
fvdiikatq

Timeline for d3tima_:

• d3tima_ first appeared (with stable ids) in SCOP 1.55
  
• d3tima_ appears in SCOP 1.75
  
• d3tima_ appears in SCOPe 2.02
  
• d3tima_ appears in the current release, SCOPe 2.08