Lineage for d1mssb_ (1mss B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (13 species) 
Species Trypanosoma brucei [TaxId:5691] [51357] (19 PDB entries) 
Domain d1mssb_: 1mss B: [28481]
Details for d1mssb_
PDB Entry: 1mss (more details), 2.4 Å
PDB Description: large scale structural rearrangements of the front loops in monomerised triosephosphate isomerase, as deduced from the comparison of the structural properties of monotim and its point mutation variant monoss
SCOP Domain Sequences for d1mssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mssb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma brucei}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
tq
SCOP Domain Coordinates for d1mssb_:
Click to download the PDB-style file with coordinates for d1mssb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mssb_:
- d1mssb_ first appeared (with stable ids) in SCOP 1.55
- d1mssb_ appears in SCOP 1.59
- d1mssb_ appears in SCOP 1.63
- d1mssb_ appears in the current release, SCOPe 2.08
View in 3D
