SCOP 1.71: Domain d1tpub_: 1tpu B:

Lineage for d1tpub_ (1tpu B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (17 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)

8. Domain d1tpub_: 1tpu B: [28442]
   complexed with pgh; mutant

Details for d1tpub_

PDB Entry: 1tpu, 1.9 Å

PDB Description: s96p change is a second-site suppressor for h95n sluggish mutant triosephosphate isomerase

SCOP Domain Sequences for d1tpub_:

Sequence; same for both SEQRES and ATOM records:

>d1tpub_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

Timeline for d1tpub_:

• d1tpub_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpub_ appears in SCOP 1.69
  
• d1tpub_ appears in SCOP 1.73
  
• d1tpub_ appears in the current release, SCOPe 2.08