PDB entry 1tpu

View 1tpu on RCSB PDB site
Description: s96p change is a second-site suppressor for h95n sluggish mutant triosephosphate isomerase
Deposited on 1994-11-07, released 1995-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tpua_
  • Chain 'B':
    Domains in SCOP 1.71: d1tpub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tpuA (A:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpuA (A:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tpuB (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqa
    qevheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
    diinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tpuB (B:)
    rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
    qncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaeglgv
    iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
    vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
    inakh