SCOP 1.75: Domain d1tpua_: 1tpu A:

Lineage for d1tpua_ (1tpu A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)

6. Protein Triosephosphate isomerase [51353] (18 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries)
   Uniprot P00940

8. Domain d1tpua_: 1tpu A: [28441]

Details for d1tpua_

PDB Entry: 1tpu, 1.9 Å

PDB Description: s96p change is a second-site suppressor for h95n sluggish mutant triosephosphate isomerase

PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1tpua_:

Sequence; same for both SEQRES and ATOM records:

>d1tpua_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilgnserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlkthvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh

Timeline for d1tpua_:

• d1tpua_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpua_ appears in SCOP 1.73
  
• d1tpua_ appears in SCOPe 2.01
  
• d1tpua_ appears in the current release, SCOPe 2.08