Class b: All beta proteins [48724] (149 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
Protein alpha-Subunit of urease [51340] (3 species) |
Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries) |
Domain d2kauc1: 2kau C:2-129,C:423-475 [28412] Other proteins in same PDB: d2kaua_, d2kaub_, d2kauc2 CASP1 complexed with cbx, ni |
PDB Entry: 2kau (more details), 2 Å
SCOP Domain Sequences for d2kauc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kauc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes} snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy rp
Timeline for d2kauc1: