Lineage for d2kauc1 (2kau C:2-129,C:423-475)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18307Fold b.92: alpha-Subunit of urease, composite domain [51337] (1 superfamily)
  4. 18308Superfamily b.92.1: alpha-Subunit of urease, composite domain [51338] (1 family) (S)
  5. 18309Family b.92.1.1: alpha-Subunit of urease, composite domain [51339] (1 protein)
  6. 18310Protein alpha-Subunit of urease, composite domain [51340] (2 species)
  7. 18316Species Klebsiella aerogenes [TaxId:28451] [51341] (25 PDB entries)
  8. 18327Domain d2kauc1: 2kau C:2-129,C:423-475 [28412]
    Other proteins in same PDB: d2kaua_, d2kaub_, d2kauc2

Details for d2kauc1

PDB Entry: 2kau (more details), 2 Å

PDB Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution

SCOP Domain Sequences for d2kauc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kauc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease, composite domain {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOP Domain Coordinates for d2kauc1:

Click to download the PDB-style file with coordinates for d2kauc1.
(The format of our PDB-style files is described here.)

Timeline for d2kauc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kauc2