Lineage for d1fwic1 (1fwi C:2-129,C:423-475)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115699Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
  4. 115700Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (2 families) (S)
  5. 115701Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 115702Protein alpha-Subunit of urease [51340] (3 species)
  7. 115712Species Klebsiella aerogenes [TaxId:28451] [51341] (25 PDB entries)
  8. 115720Domain d1fwic1: 1fwi C:2-129,C:423-475 [28407]
    Other proteins in same PDB: d1fwia_, d1fwib_, d1fwic2

Details for d1fwic1

PDB Entry: 1fwi (more details), 2 Å

PDB Description: klebsiella aerogenes urease, h134a variant

SCOP Domain Sequences for d1fwic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwic1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes}
snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy
rp

SCOP Domain Coordinates for d1fwic1:

Click to download the PDB-style file with coordinates for d1fwic1.
(The format of our PDB-style files is described here.)

Timeline for d1fwic1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwic2