Lineage for d1b12a_ (1b12 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
    contains additional all-beta subdomain inserted in the superfamily fold
  6. Protein Type 1 signal peptidase [51313] (1 species)
  7. Species Escherichia coli [TaxId:562] [51314] (6 PDB entries)
    Uniprot P00803 81-324
  8. Domain d1b12a_: 1b12 A: [28388]
    complexed with 1pn, po4

Details for d1b12a_

PDB Entry: 1b12 (more details), 1.95 Å

PDB Description: crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor
PDB Compounds: (A:) Signal peptidase I

SCOPe Domain Sequences for d1b12a_:

Sequence, based on SEQRES records: (download)

>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrl
sriggih

Sequence, based on observed residues (ATOM records): (download)

>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih

SCOPe Domain Coordinates for d1b12a_ are not available.

Timeline for d1b12a_:

Domains from other chains:
(mouse over for more information)
d1b12b_, d1b12c_, d1b12d_