Lineage for d1b12a_ (1b12 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073181Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2073182Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2073219Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
    contains additional all-beta subdomain inserted in the superfamily fold
  6. 2073220Protein Type 1 signal peptidase [51313] (1 species)
  7. 2073221Species Escherichia coli [TaxId:562] [51314] (5 PDB entries)
    Uniprot P00803 81-324
  8. 2073222Domain d1b12a_: 1b12 A: [28388]
    complexed with 1pn, po4

Details for d1b12a_

PDB Entry: 1b12 (more details), 1.95 Å

PDB Description: crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor
PDB Compounds: (A:) Signal peptidase I

SCOPe Domain Sequences for d1b12a_:

Sequence, based on SEQRES records: (download)

>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrl
sriggih

Sequence, based on observed residues (ATOM records): (download)

>d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih

SCOPe Domain Coordinates for d1b12a_:

Click to download the PDB-style file with coordinates for d1b12a_.
(The format of our PDB-style files is described here.)

Timeline for d1b12a_: