PDB entry 1b12

View 1b12 on RCSB PDB site
Description: crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor
Class: hydrolase
Keywords: serine proteinase, serine-dependant hydrolase, signal peptide processing, protein translocation, membrane bound proteinase, membrane protein, hydrolase
Deposited on 1999-11-24, released 1999-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.22
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal peptidase I
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b12a_
  • Chain 'B':
    Compound: Signal peptidase I
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b12b_
  • Chain 'C':
    Compound: Signal peptidase I
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b12c_
  • Chain 'D':
    Compound: Signal peptidase I
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: LEPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b12d_
  • Heterogens: PO4, 1PN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b12A (A:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqt
    fsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpg
    qqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglr
    lsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b12A (A:)
    rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
    edpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtf
    srrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgq
    qlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b12B (B:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqt
    fsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpg
    qqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglr
    lsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b12B (B:)
    fiyepfqipsgsmmptlligdfilvekfghpkrgdivvfkypedpkldyikravglpgdk
    vtydpvskeltiqpgccenalpvtysnvepsdfvqtfsreatsgffevpknetkengirl
    serketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsadsry
    wgfvpeanlvgrataiwmsfdlrlsriggih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b12C (C:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqt
    fsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpg
    qqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglr
    lsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b12C (C:)
    sfiyepfqipsgsmmptlligdfilvekfatghpkrgdivvfkypedpkldyikravglp
    gdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsatsgffevpknetk
    engirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdn
    sadsrywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b12D (D:)
    vrsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfky
    pedpkldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqt
    fsrrnggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpg
    qqlatwivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglr
    lsriggih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b12D (D:)
    rsfiyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkyp
    edpkldyikravglpgdkvtydpvskeltiqpalpvtysnvepsdfvqtfstsgffevpk
    netkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgd
    nrdnsadsrywgfvpeanlvgrataiwmsfdglrlsriggih