Lineage for d1f7qa_ (1f7q A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115461Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 115549Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) (S)
  5. 115550Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein)
  6. 115551Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species)
  7. 115560Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries)
  8. 115576Domain d1f7qa_: 1f7q A: [28368]

Details for d1f7qa_

PDB Entry: 1f7q (more details), 2.26 Å

PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.

SCOP Domain Sequences for d1f7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7qa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv

SCOP Domain Coordinates for d1f7qa_:

Click to download the PDB-style file with coordinates for d1f7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7qa_: