Lineage for d1fweb_ (1fwe B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427323Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2427324Protein Urease, beta-subunit [51280] (4 species)
  7. 2427352Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)
  8. 2427368Domain d1fweb_: 1fwe B: [28334]
    Other proteins in same PDB: d1fwea_, d1fwec1, d1fwec2
    complexed with hae, ni

Details for d1fweb_

PDB Entry: 1fwe (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant with acetohydroxamic acid (aha) bound
PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1fweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fweb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1fweb_:

Click to download the PDB-style file with coordinates for d1fweb_.
(The format of our PDB-style files is described here.)

Timeline for d1fweb_: