Lineage for d1fwbb_ (1fwb B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427322Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2427323Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2427324Protein Urease, beta-subunit [51280] (4 species)
  7. 2427352Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)
  8. 2427359Domain d1fwbb_: 1fwb B: [28323]
    Other proteins in same PDB: d1fwba_, d1fwbc1, d1fwbc2
    complexed with ni

Details for d1fwbb_

PDB Entry: 1fwb (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 6.5
PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1fwbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwbb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1fwbb_:

Click to download the PDB-style file with coordinates for d1fwbb_.
(The format of our PDB-style files is described here.)

Timeline for d1fwbb_: