Lineage for d1ejrb_ (1ejr B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115461Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 115511Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 115512Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 115513Protein Urease, beta-subunit [51280] (3 species)
  7. 115523Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries)
  8. 115524Domain d1ejrb_: 1ejr B: [28320]
    Other proteins in same PDB: d1ejra_, d1ejrc1, d1ejrc2

Details for d1ejrb_

PDB Entry: 1ejr (more details), 2 Å

PDB Description: crystal structure of the d221a variant of klebsiella aerogenes urease

SCOP Domain Sequences for d1ejrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejrb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOP Domain Coordinates for d1ejrb_:

Click to download the PDB-style file with coordinates for d1ejrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ejrb_: