SCOPe 2.08: Domain d1c89a2: 1c89 A:69-134

Lineage for d1c89a2 (1c89 A:69-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein Type III antifreeze protein, AFP III [51271] (3 species)

7. Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
   duplication: intramolecular dimer

8. Domain d1c89a2: 1c89 A:69-134 [28315]

Details for d1c89a2

PDB Entry: 1c89

PDB Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures

PDB Compounds: (A:) antifreeze protein type III

SCOPe Domain Sequences for d1c89a2:

Sequence; same for both SEQRES and ATOM records:

>d1c89a2 b.85.1.1 (A:69-134) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
spglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravyldqtlmpd
mvknye

Timeline for d1c89a2:

• d1c89a2 first appeared (with stable ids) in SCOP 1.55
  
• d1c89a2 appears in SCOPe 2.07