Lineage for d1c89a2 (1c89 A:69-134)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) 
Superfamily b.85.1: Type III antifreeze protein [51269] (1 family) 
Family b.85.1.1: Type III antifreeze protein [51270] (1 protein) Protein Type III antifreeze protein [51271] (2 species) 
Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni) [51273] (4 PDB entries) 
Domain d1c89a2: 1c89 A:69-134 [28315]
Details for d1c89a2
PDB Entry: 1c89 (more details)
PDB Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
SCOP Domain Sequences for d1c89a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c89a2 b.85.1.1 (A:69-134) Type III antifreeze protein {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni)}
spglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravyldqtlmpd
mvknye
SCOP Domain Coordinates for d1c89a2:
Click to download the PDB-style file with coordinates for d1c89a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c89a2:
- d1c89a2 appears in SCOP 1.57
- d1c89a2 appears in the current release, SCOPe 2.08
View in 3D
