Lineage for d1f3z__ (1f3z -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family) 
Family b.84.3.1: Glucose permease-like [51262] (2 proteins) 
Protein Glucose-specific factor III (glsIII) [51266] (1 species) Species Escherichia coli [TaxId:562] [51267] (9 PDB entries) 
Domain d1f3z__: 1f3z - [28273]
Details for d1f3z__
PDB Entry: 1f3z (more details), 1.98 Å
PDB Description: iiaglc-zn complex
SCOP Domain Sequences for d1f3z__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3z__ b.84.3.1 (-) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk
SCOP Domain Coordinates for d1f3z__:
Click to download the PDB-style file with coordinates for d1f3z__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f3z__:
- d1f3z__ first appeared (with stable ids) in SCOP 1.55
- d1f3z__ appears in SCOP 1.57
- d1f3z__ appears in SCOP 1.61
- d1f3z__ appears in the current release, SCOPe 2.08, called d1f3za_
View in 3D