Lineage for d1ax3a_ (1ax3 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332206Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 1332207Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 1332208Protein Glucose permease IIa domain, IIa-glc [51263] (2 species)
  7. 1332209Species Bacillus subtilis [TaxId:1423] [51264] (2 PDB entries)
  8. 1332211Domain d1ax3a_: 1ax3 A: [28268]

Details for d1ax3a_

PDB Entry: 1ax3 (more details)

PDB Description: solution nmr structure of b. subtilis iiaglc, 16 structures
PDB Compounds: (A:) glucose permease iia domain

SCOPe Domain Sequences for d1ax3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ax3a_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]}
miaeplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgki
lnvfptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldav
kpnvpslmtpivftnlaegetvsikasgsvnreqedivkiek

SCOPe Domain Coordinates for d1ax3a_:

Click to download the PDB-style file with coordinates for d1ax3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ax3a_: