SCOPe 2.08: Domain d1ax3a_: 1ax3 A:

Lineage for d1ax3a_ (1ax3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (3 proteins)

6. Protein Glucose permease IIa domain, IIa-glc [51263] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [51264] (2 PDB entries)

8. Domain d1ax3a_: 1ax3 A: [28268]

Details for d1ax3a_

PDB Entry: 1ax3

PDB Description: solution nmr structure of b. subtilis iiaglc, 16 structures

PDB Compounds: (A:) glucose permease iia domain

SCOPe Domain Sequences for d1ax3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ax3a_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]}
miaeplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgki
lnvfptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldav
kpnvpslmtpivftnlaegetvsikasgsvnreqedivkiek

Timeline for d1ax3a_:

• d1ax3a_ first appeared (with stable ids) in SCOP 1.55, called d1ax3__
  
• d1ax3a_ appears in SCOPe 2.07