Lineage for d1ax3__ (1ax3 -)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
sandwich of half-barrel shaped beta-sheets
Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) 
half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
Family b.84.3.1: Glucose permease-like [51262] (2 proteins) Protein Glucose permease IIa domain, IIa-glc [51263] (2 species) Species Bacillus subtilis [TaxId:1423] [51264] (2 PDB entries) 
Domain d1ax3__: 1ax3 - [28268]
Details for d1ax3__
PDB Entry: 1ax3 (more details)
PDB Description: solution nmr structure of b. subtilis iiaglc, 16 structures
SCOP Domain Sequences for d1ax3__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ax3__ b.84.3.1 (-) Glucose permease IIa domain, IIa-glc {Bacillus subtilis}
miaeplqneigeevfvspitgeihpitdvpdqvfsgkmmgdgfailpsegivvspvrgki
lnvfptkhaiglqsdggreilihfgidtvslkgegftsfvsegdrvepgqkllevdldav
kpnvpslmtpivftnlaegetvsikasgsvnreqedivkiek
SCOP Domain Coordinates for d1ax3__:
Click to download the PDB-style file with coordinates for d1ax3__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ax3__:
- d1ax3__ first appeared (with stable ids) in SCOP 1.55
- d1ax3__ appears in SCOP 1.65
- d1ax3__ appears in SCOP 1.69
- d1ax3__ appears in the current release, SCOPe 2.08, called d1ax3a_
View in 3D