| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
| Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries) |
| Domain d1fyca_: 1fyc A: [28230] |
PDB Entry: 1fyc (more details)
SCOPe Domain Sequences for d1fyca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyca_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
gsnmsypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqee
gylakilvpegtrdvplgtplciivekeadisafadyrptevtdlk
Timeline for d1fyca_: