Lineage for d1fyc__ (1fyc -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471225Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 471226Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 471227Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 471239Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 471248Species Human (Homo sapiens) [TaxId:9606] [51242] (1 PDB entry)
  8. 471249Domain d1fyc__: 1fyc - [28230]

Details for d1fyc__

PDB Entry: 1fyc (more details)

PDB Description: inner lipoyl domain from human pyruvate dehydrogenase (pdh) complex, nmr, 1 structure

SCOP Domain Sequences for d1fyc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyc__ b.84.1.1 (-) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens)}
gsnmsypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqee
gylakilvpegtrdvplgtplciivekeadisafadyrptevtdlk

SCOP Domain Coordinates for d1fyc__:

Click to download the PDB-style file with coordinates for d1fyc__.
(The format of our PDB-style files is described here.)

Timeline for d1fyc__: