| Class b: All beta proteins [48724] (144 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (1 family) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
| Species Human (Homo sapiens) [TaxId:9606] [51242] (1 PDB entry) |
| Domain d1fyc__: 1fyc - [28230] |
PDB Entry: 1fyc (more details)
SCOP Domain Sequences for d1fyc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyc__ b.84.1.1 (-) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens)}
gsnmsypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqee
gylakilvpegtrdvplgtplciivekeadisafadyrptevtdlk
Timeline for d1fyc__: