Lineage for d1qjoa_ (1qjo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560128Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1560129Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 1560141Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 1560148Species Escherichia coli [TaxId:562] [51241] (1 PDB entry)
  8. 1560149Domain d1qjoa_: 1qjo A: [28229]

Details for d1qjoa_

PDB Entry: 1qjo (more details)

PDB Description: innermost lipoyl domain of the pyruvate dehydrogenase from escherichia coli
PDB Compounds: (A:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1qjoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]}
mvkevnvpdiggdevevtevmvkvgdkvaaeqslitvegdkasmevpapfagvvkelkvn
vgdkvktgslimifevegaa

SCOPe Domain Coordinates for d1qjoa_:

Click to download the PDB-style file with coordinates for d1qjoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qjoa_: