Class b: All beta proteins [48724] (174 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
Species Escherichia coli [TaxId:562] [51241] (1 PDB entry) |
Domain d1qjoa_: 1qjo A: [28229] |
PDB Entry: 1qjo (more details)
SCOPe Domain Sequences for d1qjoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} mvkevnvpdiggdevevtevmvkvgdkvaaeqslitvegdkasmevpapfagvvkelkvn vgdkvktgslimifevegaa
Timeline for d1qjoa_: