Lineage for d1lab__ (1lab -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567972Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 567973Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 567974Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 567986Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 567990Species Bacillus stearothermophilus [TaxId:1422] [51239] (2 PDB entries)
  8. 567991Domain d1lab__: 1lab - [28226]

Details for d1lab__

PDB Entry: 1lab (more details)

PDB Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex

SCOP Domain Sequences for d1lab__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lab__ b.84.1.1 (-) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus}
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy

SCOP Domain Coordinates for d1lab__:

Click to download the PDB-style file with coordinates for d1lab__.
(The format of our PDB-style files is described here.)

Timeline for d1lab__: