Lineage for d1lab__ (1lab -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins) 
Protein Ipoyl domain of dihydrolipoamide acetyltransferase [51238] (4 species) 
Species Bacillus stearothermophilus [TaxId:1422] [51239] (2 PDB entries) 
Domain d1lab__: 1lab - [28226]
Details for d1lab__
PDB Entry: 1lab (more details)
PDB Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
SCOP Domain Sequences for d1lab__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lab__ b.84.1.1 (-) Ipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus}
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy
SCOP Domain Coordinates for d1lab__:
Click to download the PDB-style file with coordinates for d1lab__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lab__:
- d1lab__ appears in SCOP 1.57
- d1lab__ appears in the current release, SCOPe 2.08, called d1laba_
View in 3D