SCOP 1.71: Domain d1lac__: 1lac -

Lineage for d1lac__ (1lac -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (1 family)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Bacillus stearothermophilus [TaxId:1422] [51239] (2 PDB entries)

8. Domain d1lac__: 1lac - [28225]

Details for d1lac__

PDB Entry: 1lac

PDB Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex

SCOP Domain Sequences for d1lac__:

Sequence; same for both SEQRES and ATOM records:

>d1lac__ b.84.1.1 (-) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus}
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy

Timeline for d1lac__:

• d1lac__ first appeared (with stable ids) in SCOP 1.55
  
• d1lac__ appears in SCOP 1.69
  
• d1lac__ is called d1laca_ in SCOP 1.73
  
• d1lac__ appears in the current release, SCOPe 2.08, called d1laca_