Lineage for d1lac__ (1lac -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18007Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 18008Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
  5. 18009Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins)
  6. 18020Protein Ipoyl domain of dihydrolipoamide acetyltransferase [51238] (4 species)
  7. 18024Species Bacillus stearothermophilus [TaxId:1422] [51239] (2 PDB entries)
  8. 18025Domain d1lac__: 1lac - [28225]

Details for d1lac__

PDB Entry: 1lac (more details)

PDB Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex

SCOP Domain Sequences for d1lac__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lac__ b.84.1.1 (-) Ipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus}
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy

SCOP Domain Coordinates for d1lac__:

Click to download the PDB-style file with coordinates for d1lac__.
(The format of our PDB-style files is described here.)

Timeline for d1lac__: