| Class b: All beta proteins [48724] (141 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (1 family) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Protein H of glycine cleavage system [51236] (2 species) |
| Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries) |
| Domain d1dxma_: 1dxm A: [28223] |
PDB Entry: 1dxm (more details), 2.6 Å
SCOP Domain Sequences for d1dxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxma_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum)}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah
Timeline for d1dxma_: