Lineage for d1dxma_ (1dxm A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins) 
Protein Protein H of glycine cleavage system [51236] (1 species) Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries) 
Domain d1dxma_: 1dxm A: [28223]
Details for d1dxma_
PDB Entry: 1dxm (more details), 2.6 Å
PDB Description: reduced form of the h protein from glycine decarboxylase complex
SCOP Domain Sequences for d1dxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxma_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum)}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah
SCOP Domain Coordinates for d1dxma_:
Click to download the PDB-style file with coordinates for d1dxma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dxma_:
- d1dxma_ appears in SCOP 1.57
- d1dxma_ appears in the current release, SCOPe 2.08
View in 3D
