Lineage for d2bdoa_ (2bdo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1808933Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1808934Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 1808940Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species)
  7. 1808941Species Escherichia coli [TaxId:562] [51233] (4 PDB entries)
  8. 1808945Domain d2bdoa_: 2bdo A: [28216]
    complexed with btn

Details for d2bdoa_

PDB Entry: 2bdo (more details)

PDB Description: solution structure of holo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
PDB Compounds: (A:) protein (acetyl-coa carboxylase)

SCOPe Domain Sequences for d2bdoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]}
eisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvk
ailvesgqpvefdeplvvie

SCOPe Domain Coordinates for d2bdoa_:

Click to download the PDB-style file with coordinates for d2bdoa_.
(The format of our PDB-style files is described here.)

Timeline for d2bdoa_: