PDB entry 2bdo

View 2bdo on RCSB PDB site
Description: solution structure of holo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Class: biotin
Keywords: biotin, biotinyl domain, acetyl coa carboxylase, swinging arm, nmr spectroscopy, protein structure
Deposited on 1999-03-03, released 1999-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (acetyl-coa carboxylase)
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bdoa_
  • Heterogens: BTN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bdoA (A:)
    eisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvk
    ailvesgqpvefdeplvvie