Lineage for d1qawh_ (1qaw H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963855Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 963856Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
    oligomeric ring consists of 11 single-domain subunits
  6. 963857Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 963858Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)
  8. 964013Domain d1qawh_: 1qaw H: [28204]
    complexed with trp

Details for d1qawh_

PDB Entry: 1qaw (more details), 2.5 Å

PDB Description: Regulatory Features of the TRP Operon and the Crystal Structure of the TRP RNA-Binding Attenuation Protein from Bacillus Stearothermophilus.
PDB Compounds: (H:) trp RNA-binding attenuation protein

SCOPe Domain Sequences for d1qawh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qawh_ b.82.5.1 (H:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvieseg

SCOPe Domain Coordinates for d1qawh_:

Click to download the PDB-style file with coordinates for d1qawh_.
(The format of our PDB-style files is described here.)

Timeline for d1qawh_: