Lineage for d1qawa_ (1qaw A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115107Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 115264Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 115265Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 115266Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 115267Species Bacillus stearothermophilus [TaxId:1422] [51223] (2 PDB entries)
  8. 115290Domain d1qawa_: 1qaw A: [28197]

Details for d1qawa_

PDB Entry: 1qaw (more details), 2.5 Å

PDB Description: Regulatory Features of the TRP Operon and the Crystal Structure of the TRP RNA-Binding Attenuation Protein from Bacillus Stearothermophilus.

SCOP Domain Sequences for d1qawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qawa_ b.82.5.1 (A:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgviese

SCOP Domain Coordinates for d1qawa_:

Click to download the PDB-style file with coordinates for d1qawa_.
(The format of our PDB-style files is described here.)

Timeline for d1qawa_: