Lineage for d1c9sm_ (1c9s M:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171927Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 171928Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 171929Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 171930Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)
  8. 171965Domain d1c9sm_: 1c9s M: [28187]

Details for d1c9sm_

PDB Entry: 1c9s (more details), 1.9 Å

PDB Description: crystal structure of a complex of trp rna-binding attenuation protein with a 53-base single stranded rna containing eleven gag triplets separated by au dinucleotides

SCOP Domain Sequences for d1c9sm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9sm_ b.82.5.1 (M:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgviesegk

SCOP Domain Coordinates for d1c9sm_:

Click to download the PDB-style file with coordinates for d1c9sm_.
(The format of our PDB-style files is described here.)

Timeline for d1c9sm_: