![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.5: TRAP-like [51219] (2 families) ![]() shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
![]() | Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins) oligomeric ring consists of 11 single-domain subunits automatically mapped to Pfam PF02081 |
![]() | Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry) |
![]() | Domain d1wapm_: 1wap M: [28165] protein/RNA complex; complexed with trp |
PDB Entry: 1wap (more details), 1.8 Å
SCOPe Domain Sequences for d1wapm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wapm_ b.82.5.1 (M:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis [TaxId: 1423]} dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay gemksekk
Timeline for d1wapm_: