| Class b: All beta proteins [48724] (176 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: TRAP-like [51219] (2 families) ![]() shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
| Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins) oligomeric ring consists of 11 single-domain subunits automatically mapped to Pfam PF02081 |
| Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry) |
| Domain d1wape_: 1wap E: [28157] protein/RNA complex; complexed with trp |
PDB Entry: 1wap (more details), 1.8 Å
SCOPe Domain Sequences for d1wape_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wape_ b.82.5.1 (E:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis [TaxId: 1423]}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek
Timeline for d1wape_: