Lineage for d1wape_ (1wap E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171927Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 171928Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 171929Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 172008Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 172013Domain d1wape_: 1wap E: [28157]

Details for d1wape_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wape_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wape_ b.82.5.1 (E:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek

SCOP Domain Coordinates for d1wape_:

Click to download the PDB-style file with coordinates for d1wape_.
(The format of our PDB-style files is described here.)

Timeline for d1wape_: