Lineage for d2araa_ (2ara A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810524Superfamily b.82.4: Regulatory protein AraC [51215] (1 family) (S)
  5. 810525Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)
  6. 810526Protein Regulatory protein AraC [51217] (1 species)
    contains an alpha-hairpin in the C-terminal extension
  7. 810527Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)
    Uniprot P03021
  8. 810537Domain d2araa_: 2ara A: [28152]

Details for d2araa_

PDB Entry: 2ara (more details), 2.8 Å

PDB Description: apo form of escherichia coli regulatory protein arac
PDB Compounds: (A:) arac

SCOP Domain Sequences for d2araa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2araa_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
lvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillfppge
ihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlfgqii
nagqgegrysellainlleqlllrrmeai

SCOP Domain Coordinates for d2araa_:

Click to download the PDB-style file with coordinates for d2araa_.
(The format of our PDB-style files is described here.)

Timeline for d2araa_: