Lineage for d2ara__ (2ara -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies) 
Superfamily b.82.4: Regulatory protein AraC [51215] (1 family) 
Family b.82.4.1: Regulatory protein AraC [51216] (1 protein) Protein Regulatory protein AraC [51217] (1 species) Species Escherichia coli [TaxId:562] [51218] (3 PDB entries) 
Domain d2ara__: 2ara - [28152]
Details for d2ara__
PDB Entry: 2ara (more details), 2.8 Å
PDB Description: apo form of escherichia coli regulatory protein arac
SCOP Domain Sequences for d2ara__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ara__ b.82.4.1 (-) Regulatory protein AraC {Escherichia coli}
lvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillfppge
ihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlfgqii
nagqgegrysellainlleqlllrrmeai
SCOP Domain Coordinates for d2ara__:
Click to download the PDB-style file with coordinates for d2ara__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ara__:
- d2ara__ appears in SCOP 1.57
- d2ara__ appears in the current release, SCOPe 2.08, called d2araa_
View in 3D