Lineage for d1ewwa_ (1eww A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677067Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 677245Superfamily b.81.2: An insect antifreeze protein [51177] (1 family) (S)
    superhelical turns are made of three short strands
  5. 677246Family b.81.2.1: An insect antifreeze protein [51178] (1 protein)
    this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain
  6. 677247Protein Thermal hysteresis protein [51179] (2 species)
    there are different numbers of superhelical turns (and sequence repeats) in different isoforms
  7. 677248Species Spruce budworm (Choristoneura fumiferana), 5-turn isoforms [TaxId:7141] [88689] (3 PDB entries)
  8. 677253Domain d1ewwa_: 1eww A: [28075]

Details for d1ewwa_

PDB Entry: 1eww (more details)

PDB Description: solution structure of spruce budworm antifreeze protein at 30 degrees celsius
PDB Compounds: (A:) antifreeze protein

SCOP Domain Sequences for d1ewwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewwa_ b.81.2.1 (A:) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 5-turn isoforms [TaxId: 7141]}
dgsctntnsqlsanskcekstltncyvdksevygttctgsrfdgvtittststgsrisgp
gckistciitggvpapsaackisgctfsan

SCOP Domain Coordinates for d1ewwa_:

Click to download the PDB-style file with coordinates for d1ewwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ewwa_: