SCOP 1.71: Domain d1ewwa_: 1eww A:

Lineage for d1ewwa_ (1eww A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.2: An insect antifreeze protein [51177] (1 family)
   superhelical turns are made of three short strands

5. Family b.81.2.1: An insect antifreeze protein [51178] (1 protein)
   this is a repeat family; one repeat unit is 1m8n A:50-65 found in domain

6. Protein Thermal hysteresis protein [51179] (2 species)
   there are different numbers of superhelical turns (and sequence repeats) in different isoforms

7. Species Spruce budworm (Choristoneura fumiferana), 5-turn isoforms [TaxId:7141] [88689] (3 PDB entries)

8. Domain d1ewwa_: 1eww A: [28075]

Details for d1ewwa_

PDB Entry: 1eww

PDB Description: solution structure of spruce budworm antifreeze protein at 30 degrees celsius

SCOP Domain Sequences for d1ewwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ewwa_ b.81.2.1 (A:) Thermal hysteresis protein {Spruce budworm (Choristoneura fumiferana), 5-turn isoforms}
dgsctntnsqlsanskcekstltncyvdksevygttctgsrfdgvtittststgsrisgp
gckistciitggvpapsaackisgctfsan

Timeline for d1ewwa_:

• d1ewwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ewwa_ appears in SCOP 1.69
  
• d1ewwa_ appears in SCOP 1.73
  
• d1ewwa_ appears in the current release, SCOPe 2.08