SCOPe 2.05: Domain d4y0ud_: 4y0u D:

Lineage for d4y0ud_ (4y0u D:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (31 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries)

8. Domain d4y0ud_: 4y0u D: [280521]
   automated match to d4k0xa_
   complexed with alp

Details for d4y0ud_

PDB Entry: 4y0u, 2.6 Å

PDB Description: crystal structure of 6alpha-hydroxymethylpenicillanate complexed with oxa-58, a carbapenem hydrolyzing class d betalactamase from acinetobacter baumanii.

PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d4y0ud_:

Sequence; same for both SEQRES and ATOM records:

>d4y0ud_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
nsiidqnvqalfneisadavfvtydgqnikkygthldraktayipastfkianaliglen
hkatsteifkwdgkprffkawdkdftlgeamqastvpvyqelarrigpslmqselqrigy
gnmqigtevdqfwlkgpltitpiqevkfvydlaqgqlpfkpevqqqvkemlyverrgenr
lyaksgwgmavdpqvgwyvgfvekadgqvvafalnmqmkagddialrkqlsldvldklgv
fhy

Timeline for d4y0ud_:

• d4y0ud_ is new in SCOPe 2.05-stable
  
• d4y0ud_ appears in SCOPe 2.06
  
• d4y0ud_ appears in the current release, SCOPe 2.08