SCOPe 2.07: Domain d4xcsf1: 4xcs F:1-176

Lineage for d4xcsf1 (4xcs F:1-176)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)

8. Domain d4xcsf1: 4xcs F:1-176 [280496]
   Other proteins in same PDB: d4xcsa2, d4xcsc2, d4xcsf2
   automated match to d3tkpc_
   complexed with cps, gol; mutant

Details for d4xcsf1

PDB Entry: 4xcs, 2.1 Å

PDB Description: human peroxiredoxin-1 c83s mutant

PDB Compounds: (F:) Peroxiredoxin-1

SCOPe Domain Sequences for d4xcsf1:

Sequence; same for both SEQRES and ATOM records:

>d4xcsf1 c.47.1.10 (F:1-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mssgnakighpapnfkatavmpdgqfkdislsdykgkyvvfffypldftfvcpteiiafs
draeefkklncqvigasvdshfshlawvntpkkqgglgpmniplvsdpkrtiaqdygvlk
adegisfrglfiiddkgilrqitvndlpvgrsvdetlrlvqafqftdkhgevcpag

Timeline for d4xcsf1:

• d4xcsf1 first appeared in SCOPe 2.05, called d4xcsf_
  
• d4xcsf1 appears in SCOPe 2.06
  
• d4xcsf1 appears in the current release, SCOPe 2.08