Lineage for d2n40a_ (2n40 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607961Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 2607968Protein TSG-6, Link module [56478] (1 species)
  7. 2607969Species Human (Homo sapiens) [TaxId:9606] [56479] (5 PDB entries)
  8. 2607975Domain d2n40a_: 2n40 A: [280462]
    automated match to d1o7bt_

Details for d2n40a_

PDB Entry: 2n40 (more details)

PDB Description: solution structure of the link module of human tsg-6 in presence of a chondroitin 4-sulfate hexasaccharide
PDB Compounds: (A:) tumor necrosis factor-inducible gene 6 protein

SCOPe Domain Sequences for d2n40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n40a_ d.169.1.4 (A:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak

SCOPe Domain Coordinates for d2n40a_:

Click to download the PDB-style file with coordinates for d2n40a_.
(The format of our PDB-style files is described here.)

Timeline for d2n40a_: