Lineage for d5f6hn2 (5f6h N:112-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2364744Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)
  8. 2364776Domain d5f6hn2: 5f6h N:112-213 [280406]
    Other proteins in same PDB: d5f6hj1, d5f6hl1, d5f6hn1, d5f6hp1
    automated match to d1aqkl2

Details for d5f6hn2

PDB Entry: 5f6h (more details), 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
PDB Compounds: (N:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6hn2 b.1.1.2 (N:112-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5f6hn2:

Click to download the PDB-style file with coordinates for d5f6hn2.
(The format of our PDB-style files is described here.)

Timeline for d5f6hn2: