Lineage for d5dpia_ (5dpi A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2546832Protein Green fluorescent protein, GFP [54513] (5 species)
  7. 2546838Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
    Uniprot P42212
  8. 2547194Domain d5dpia_: 5dpi A: [280326]
    automated match to d3st2a_
    mutant

Details for d5dpia_

PDB Entry: 5dpi (more details), 2.54 Å

PDB Description: sfgfp double mutant - 133/149 p-cyano-l-phenylalanine
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5dpia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpia_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvtt
lgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkexgnilghkleynfnshxvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d5dpia_:

Click to download the PDB-style file with coordinates for d5dpia_.
(The format of our PDB-style files is described here.)

Timeline for d5dpia_: