Lineage for d1qcxa_ (1qcx A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63489Fold b.80: Single-stranded right-handed beta-helix [51125] (3 superfamilies)
  4. 63490Superfamily b.80.1: Pectin lyase-like [51126] (7 families) (S)
  5. 63504Family b.80.1.2: Pectin lyase [51133] (1 protein)
    this is a repeat family; one repeat unit is 1idj A:227-250 found in domain
  6. 63505Protein Pectin lyase [51134] (2 species)
  7. 63510Species Aspergillus niger, type B [TaxId:5061] [51136] (1 PDB entry)
  8. 63511Domain d1qcxa_: 1qcx A: [28028]

Details for d1qcxa_

PDB Entry: 1qcx (more details), 1.7 Å

PDB Description: pectin lyase b

SCOP Domain Sequences for d1qcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B}
agvvgaaegfahgvtgggsaspvyptttdelvsylgdneprviildqtfdftgtegtett
tgcapwgtasqcqvainlhswcdnyqasapkvsvtydkagilpitvnsnksivgqgtkgv
ikgkglrvvsgaknviiqniavtdinpkyvwggdaitvddsdlvwidhvttarigrqhiv
lgtsadnrvtisyslidgrsdysatcnghhywgvyldgsndmvtlkgnyfynlsgrmpkv
qgntllhavnnlfhnfdghafeigtggyvlaegnvfqdvnvvvetpisgqlfsspdantn
qqcasvfgrscqlnafgnsgsmsgsdtsiiskfagktiaaahppgaiaqwtmknagqgk

SCOP Domain Coordinates for d1qcxa_:

Click to download the PDB-style file with coordinates for d1qcxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qcxa_: